Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.007G190600_circ_g.1 |
| ID in PlantcircBase | gra_circ_000743 |
| Alias | Chr07:18659895|18660239 |
| Organism | Gossypium raimondii |
| Position | chrChr07: 18659895-18660239 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.007G190600 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.007G190600.1:2 Gorai.007G190600.2:2 Gorai.007G190600.5:2 Gorai.007G190600.4:2 Gorai.007G190600.3:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.561676498 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18660181-18660236(+) 18659985-18660176(-) |
| Potential amino acid sequence |
MDEFNTKNGGQRIATVLMYLVRTSSGTFLPRGRDKIIRNIEQRIADFTFIPVEHGEGLQVLHYE VGQKYEPHFDYFMDEFNTKNGGQRIATVLMYLVRTSSGTFLPRGRDKIIRNIEQRIADFTFIPV EHGEGLQVLHYEVGQKYEPHFDYFMDEFNTKNGGQRIATVLMYLVRTSSGTFLPRGRDKIIRNI EQRIADFTFIPVEHGEGLQVLHYEVGQKYEPHFDYFMDEFNTKNGGQRIATVLMY(+) MKVKSAILCSMFLIILSRPLGRNVPELVRTRYIRTVAMRWPPFLVLNSSMK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |