Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0559400_circ_g.1 |
| ID in PlantcircBase | osa_circ_024837 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 28027480-28028483 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0559400 |
| Parent gene annotation |
Similar to Branched-chain-amino-acid aminotransferase 5, chlorop last precursor (EC 2.6.1.42) (Atbcat-5). (Os04t0559400-01);Simil ar to Branched-chain-amino-acid aminotransferase. (Os04t0559400- 02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0559400-01:3 Os04t0559400-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.132996721 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28028416-28027914(+) 28028377-28028371(-) |
| Potential amino acid sequence |
MHWIQVKNIRMTSLLSSFFSINGLLPWYTMQPTEDSTTEVPVQKTSSASSNSSIVIRHSST*(+ ) MVKDNIISTPLLTGTVLPGITRRSIIEYARSLGFQVEECLITIDELLDADEVFCTGTSVVLSSV GCIVYQGRRPFMLKKELRREVILMFFTWIQCIKSLLRNFRPVIYSW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |