Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0561400_circ_g.2 |
ID in PlantcircBase | osa_circ_008010 |
Alias | Os10circ09903 |
Organism | Oryza sativa |
Position | chr10: 22133464-22136186 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | SMALT, Segemehl |
Parent gene | Os10g0561400 |
Parent gene annotation |
Similar to Transcription factor MYBS3. (Os10t0561400-01);Similar to Transcription factor MYBS3. (Os10t0561400-02);Similar to Myb transcription factor. (Os10t0561400-03) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os10t0561400-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_008705 |
PMCS | 0.09175777 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22136181-22133714(+) |
Potential amino acid sequence |
MHPASSNANNIRAAQGVADRARTCMYTEYLYIRVVWYTNS*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015 |