Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0561400_circ_g.2 |
| ID in PlantcircBase | osa_circ_008010 |
| Alias | Os10circ09903 |
| Organism | Oryza sativa |
| Position | chr10: 22133464-22136186 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os10g0561400 |
| Parent gene annotation |
Similar to Transcription factor MYBS3. (Os10t0561400-01);Similar to Transcription factor MYBS3. (Os10t0561400-02);Similar to Myb transcription factor. (Os10t0561400-03) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0561400-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_008705 |
| PMCS | 0.09175777 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22136181-22133714(+) |
| Potential amino acid sequence |
MHPASSNANNIRAAQGVADRARTCMYTEYLYIRVVWYTNS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |