Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G12840_circ_g.8 |
ID in PlantcircBase | ath_circ_002310 |
Alias | AT1G12840_C1, AT1G12840_C1 |
Organism | Arabidpsis thaliana |
Position | chr1: 4376488-4377161 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | AT1G12840 |
Parent gene annotation |
V-type proton ATPase subunit C |
Parent gene strand | + |
Alternative splicing | AT1G12840_circ_g.4 AT1G12840_circ_g.5 AT1G12840_circ_g.6 AT1G12840_circ_g.7 AT1G12840_circ_g.9 AT1G12840_circ_g.10 AT1G12840_circ_g.11 AT1G12840_circ_g.12 AT1G12840_circ_g.13 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G12840.1:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.190948194 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4376942-4376805(+) |
Potential amino acid sequence |
MWFLGPRRNCLRIMSMPFTPSLSLLVSQIISGLLLVRKDSKFVLLNITISVVNSMPLTESKVEA * |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Zhang et al., 2019 |