Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G36530_circ_g.6 |
| ID in PlantcircBase | ath_circ_035056 |
| Alias | At_ciR2058 |
| Organism | Arabidpsis thaliana |
| Position | chr4: 17241482-17241589 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | ue-circRNA |
| Identification method | find_circ, circseq_cup, CIRI-full |
| Parent gene | AT4G36530 |
| Parent gene annotation |
Alpha/beta-Hydrolases superfamily protein |
| Parent gene strand | - |
| Alternative splicing | AT4G36530_circ_g.1 AT4G36530_circ_g.2 AT4G36530_circ_g.3 AT4G36530_circ_g.4 AT4G36530_circ_g.5 |
| Support reads | 4 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT4G36530.2:1 AT4G36530.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.373337365 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17241519-17241484(-) |
| Potential amino acid sequence |
MDTSSASSQSVQGNKCEISRRDFAIRGGIVASGVSVMDTSSASSQSVQGNKCEISRRDFAIRGG IVASGVSVMDTSSASSQSVQGNKCEISRRDFAIRGGIVASGVSVMDTSSASSQSVQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |