Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_17G192200_circ_g.2 |
| ID in PlantcircBase | gma_circ_004547 |
| Alias | Gm17circRNA370 |
| Organism | Glycine max |
| Position | chr17: 27563545-27564727 JBrowse» |
| Reference genome | v2.0.38 |
| Type | ue-circRNA |
| Identification method | Tophat |
| Parent gene | GLYMA_17G192200 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | GLYMA_17G192200_circ_g.1 GLYMA_17G192200_circ_g.3 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRH04864:2 KRH04865:1 KRH04866:2 KRH04863:1 KRH04862:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.041136609 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27564035-27564583(-) |
| Potential amino acid sequence |
MIDNTQMPFGEVSTVSKKFESFRAQHFRLLMENLCVLEETFVDSEALRLEKAIILQLGKLGALE LFNVCLSRSLGTSLVSNYADKVDDYKDKVVVQSSKKKENKTRRKREFVSTAVSSQSLTLKANQE DLLGFSASLVKRAPNTKNKRILVAKREAEMSKGVKLESGKLVSTSRGYLSPQHFMRKEKLCKRI LEGCLHFHHQPWKPWKMIH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017a |