Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0462800_circ_g.3 |
| ID in PlantcircBase | osa_circ_007019 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 17046000-17046617 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0462800 |
| Parent gene annotation |
Component of the plastid-encoded plastid RNA polymerase (PEP), p eripheral subunit of PEP complex, OsPAP1/OspTAC3, Early chloropl ast development (Os10t0462800-01) |
| Parent gene strand | + |
| Alternative splicing | Os10g0462800_circ_g.1 Os10g0462800_circ_g.2 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0462800-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.329198153 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17046055-17046132(+) 17046529-17046571(-) |
| Potential amino acid sequence |
MRETRLFDVSDMYTTADAWGWTWEREIKNKMPRKWSQEWEVELAIKIMHKVIDLGGTPTIGDCA IILRAAMRVPLPSAFMTILQTTHSLGYKFGRLMMMKIGFLKTQLKLLRLCVRQGCSMCQICILL QMLGDGHGKER*(+) MAQSPIVGVPPRSITLCIILIANSTSHSCDHLRGILFFISLSHVHPQASAVVYISDTSNNLVSR ITLKASIGSSGNQSSSSSIFQICSQGYALFAILS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |