Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G31730_circ_g.10 |
ID in PlantcircBase | ath_circ_005286 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 11362567-11362644 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT1G31730 |
Parent gene annotation |
AP-4 complex subunit epsilon |
Parent gene strand | + |
Alternative splicing | AT1G31730_circ_g.3 AT1G31730_circ_g.4 AT1G31730_circ_g.5 AT1G31730_circ_g.6 AT1G31730_circ_g.7 AT1G31730_circ_g.8 AT1G31730_circ_g.9 |
Support reads | 1 |
Tissues | aerial |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G31730.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.16025641 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11362588-11362641(+) 11362616-11362569(-) |
Potential amino acid sequence |
MKIYAFEIASGRKVDVLPEGYAVSALMKIYAFEIASGRKVDVLPEGYAVSALMKIYAFEIASGR KVDVLPEGYAVSALMKIYAFEIASGRKVDVLPE(+) MQFQMRRSSSVQKQHNPPAKHPPFSQMQFQMRRSSSVQKQHNPPAKHPPFSQMQFQMRRSSSVQ KQHNPPAKHPPFSQMQFQMRRSSSVQKQHN(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |