Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G31730_circ_g.10 |
| ID in PlantcircBase | ath_circ_005286 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 11362567-11362644 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT1G31730 |
| Parent gene annotation |
AP-4 complex subunit epsilon |
| Parent gene strand | + |
| Alternative splicing | AT1G31730_circ_g.3 AT1G31730_circ_g.4 AT1G31730_circ_g.5 AT1G31730_circ_g.6 AT1G31730_circ_g.7 AT1G31730_circ_g.8 AT1G31730_circ_g.9 |
| Support reads | 1 |
| Tissues | aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G31730.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.16025641 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11362588-11362641(+) 11362616-11362569(-) |
| Potential amino acid sequence |
MKIYAFEIASGRKVDVLPEGYAVSALMKIYAFEIASGRKVDVLPEGYAVSALMKIYAFEIASGR KVDVLPEGYAVSALMKIYAFEIASGRKVDVLPE(+) MQFQMRRSSSVQKQHNPPAKHPPFSQMQFQMRRSSSVQKQHNPPAKHPPFSQMQFQMRRSSSVQ KQHNPPAKHPPFSQMQFQMRRSSSVQKQHN(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |