Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0847600_circ_g.4 |
| ID in PlantcircBase | osa_circ_022702 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 35635528-35636203 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0847600 |
| Parent gene annotation |
Similar to GAMYB-binding protein. (Os03t0847600-01);Similar to G AMYB-binding protein. (Os03t0847600-02) |
| Parent gene strand | + |
| Alternative splicing | Os03g0847600_circ_g.5 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0847600-02:4 Os03t0847600-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.230040668 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35635598-35635549(+) 35635771-35635541(+) |
| Potential amino acid sequence |
MVQILQGLAYMHNNGYFHRDLKPENLLVTDGTVKIADFGLAREVSSSPPYTDYVSTRWYRAPEV LLQSSAYTPAIDMWAVGAILAELFTLSPLFPGGRNAICMMS*(+) MALLKLLTLGWQEKYLPVLLILTMFPPDGIELQRCCYNRQLTHLLLICGLLVQFWLSFSHCLHF SLVEGMQFV*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |