Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0195300_circ_g.1 |
| ID in PlantcircBase | osa_circ_018350 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 4949712-4949886 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os03g0195300 |
| Parent gene annotation |
Similar to Low affinity sulphate transporter 3. (Os03t0195300-01 ) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0195300-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.199053143 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4949837-4949723(+) 4949839-4949781(-) 4949760-4949781(-) |
| Potential amino acid sequence |
MNPTIAACDRKSTRNPSCFVN*(+) MGGAAIVIGLQQLKGLLGLSHFTNRTDVVSVTKAVWVSVHETTGISCGFSITCCYRRVHGRSCY CDWITAAEGAAWT*(-) MSSLSPRQSGFQFTKQLGFLVDFLSHAAIVGFMGGAAIVIGLQQLKGLLGLSHFTNRTDVVSVT KAVWVSVHETTGISCGFSITCCYRRVHGRSCYCDWITAAEGAAWT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |