Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0499900_circ_g.10 |
| ID in PlantcircBase | osa_circ_030977 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 17605346-17606861 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os06g0499900 |
| Parent gene annotation |
Similar to Dihydrolipoamide acetyltransferase (E2) subunit of PD C (Fragment). (Os06t0499900-01) |
| Parent gene strand | - |
| Alternative splicing | Os06g0499900_circ_g.9 Os06g0499900_circ_g.11 |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0499900-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.102534532 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17605501-17605385(+) 17606760-17605382(-) |
| Potential amino acid sequence |
MQASQPPDEEETLLRITNEFPWEPCNVCPVTLDMKAFSPSCFLHFAMLP*(+) MEIRWLSSTGFPPHLVVGMPALSPTMNQGNIAKWRKQEGEKAFISSVTGQTLQGSHGNSLVILN RVSSSSGGWDACIIPYYESR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |