Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0442300_circ_g.1 |
ID in PlantcircBase | osa_circ_037222 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 21552177-21552572 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0442300 |
Parent gene annotation |
Similar to Calcineurin subunit B. (Os08t0442300-01);Similar to C alcineurin subunit B. (Os08t0442300-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0442300-02:2 Os08t0442300-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_017934 |
PMCS | 0.259593434 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21552255-21552275(+) 21552537-21552534(-) |
Potential amino acid sequence |
MGSTSSMLTQYDIEEVQDHCDHAFSQQEIVSLYHRFCQLDRNGGGFVSAEEFMTVPEFAVNPLS QIGLRFREDPRPDPNFGRPGSPSPPPRWGAPRRC*(+) MNSSAETNPPPFRSSWQNRWYSDTISCCEKAWSQWSWTSSMSYCVSIDEVLPISAEETGIPVGQ NSDPGGDPPGIEVQSEREGSRRTRGRS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |