Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0442300_circ_g.1 |
| ID in PlantcircBase | osa_circ_037222 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 21552177-21552572 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0442300 |
| Parent gene annotation |
Similar to Calcineurin subunit B. (Os08t0442300-01);Similar to C alcineurin subunit B. (Os08t0442300-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0442300-02:2 Os08t0442300-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_017934 |
| PMCS | 0.259593434 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21552255-21552275(+) 21552537-21552534(-) |
| Potential amino acid sequence |
MGSTSSMLTQYDIEEVQDHCDHAFSQQEIVSLYHRFCQLDRNGGGFVSAEEFMTVPEFAVNPLS QIGLRFREDPRPDPNFGRPGSPSPPPRWGAPRRC*(+) MNSSAETNPPPFRSSWQNRWYSDTISCCEKAWSQWSWTSSMSYCVSIDEVLPISAEETGIPVGQ NSDPGGDPPGIEVQSEREGSRRTRGRS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |