Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G27340_circ_g.1 |
| ID in PlantcircBase | ath_circ_015183 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr2: 11697648-11697854 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | ue-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT2G27340 |
| Parent gene annotation |
At2g27340 |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT2G27340.5:2 AT2G27340.2:2 AT2G27340.4:2 AT2G27340.3:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.236411192 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11697662-11697851(+) |
| Potential amino acid sequence |
MFVIAHPDDESMFFSPTINYFTSTACNLHILCFSTGKKNVMFVIAHPDDESMFFSPTINYFTST ACNLHILCFSTGKKNVMFVIAHPDDESMFFSPTINYFTSTACNLHILCFSTGKKNVMFVIAHPD DESMFFSPTINYFTSTACNLHILCFST(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |