Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0502000_circ_g.1 |
ID in PlantcircBase | osa_circ_028425 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 24713799-24714431 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os05g0502000 |
Parent gene annotation |
Similar to Cyclic nucleotide-gated ion channel 4 (AtCNGC4) (Cycl ic nucleotide-and calmodulin-regulated ion channel 4) (AtHLM1). (Os05t0502000-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 6 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0502000-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_006329* |
PMCS | 0.273415192 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24713827-24713826(+) 24713883-24714430(-) |
Potential amino acid sequence |
MIRAGSTTAVMTVMLVAFMLEYLPKIYHSVVFLRRMQNQSGHIFGTIWWGIALNLIAYFVAAHA VGACWYLLGVQRATKCLKEQCLLAGLPACASSTAAVACVDPLYYGAAVASVGGDRLAWGGNATA RNVCLSSGDNYQYGAYKWTVMLVSNPSRLEKMLLPIFWGLMTLRWWFGWRRRR*(+) MNATSITVITAVVDPARIIAGAATQTTT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |