Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0502000_circ_g.1 |
| ID in PlantcircBase | osa_circ_028425 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 24713799-24714431 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os05g0502000 |
| Parent gene annotation |
Similar to Cyclic nucleotide-gated ion channel 4 (AtCNGC4) (Cycl ic nucleotide-and calmodulin-regulated ion channel 4) (AtHLM1). (Os05t0502000-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 6 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0502000-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_006329* |
| PMCS | 0.273415192 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24713827-24713826(+) 24713883-24714430(-) |
| Potential amino acid sequence |
MIRAGSTTAVMTVMLVAFMLEYLPKIYHSVVFLRRMQNQSGHIFGTIWWGIALNLIAYFVAAHA VGACWYLLGVQRATKCLKEQCLLAGLPACASSTAAVACVDPLYYGAAVASVGGDRLAWGGNATA RNVCLSSGDNYQYGAYKWTVMLVSNPSRLEKMLLPIFWGLMTLRWWFGWRRRR*(+) MNATSITVITAVVDPARIIAGAATQTTT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |