Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d010309_circ_g.2 |
| ID in PlantcircBase | zma_circ_009661 |
| Alias | zma_circ_0002786 |
| Organism | Zea mays |
| Position | chr8: 109072072-109072540 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d010309 |
| Parent gene annotation |
Squamosa promoter-binding protein-like (SBP domain) transcriptio n factor family protein |
| Parent gene strand | + |
| Alternative splicing | Zm00001d010309_circ_g.1 Zm00001d010309_circ_g.3 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d010309_T004:2 Zm00001d010309_T001:2 Zm00001d010309_T005:2 Zm00001d010309_T008:2 Zm00001d010309_T003:2 Zm00001d010309_T002:2 Zm00001d010309_T009:2 Zm00001d010309_T006:2 Zm00001d010309_T007:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.218902583 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
109072298-109072093(+) 109072078-109072086(+) 109072484-109072490(-) |
| Potential amino acid sequence |
MTPRVHIHPRVQQGASHSSCMIGILQNFLDDYDTREHGRHNQ*(+) MEGITSEILETVLSNKVMDRETPVGSEDVLSSPTCTQPCLQNDQSKSVVTFAASVEACIGAKQE SIKLANSPMHDTKSAYSSSCPTGRISFKLYDWNPAEFPRRLRHQRTWKA*(+) MRPVGHEDEYALLVSCIGELASFMLSCFAPMQASTEAAKVTTLLLWSFCKQGCVQVGELSTSSD PTGVSLSITLLLRTVSRISLVMPSMFSGVVVVEEILQDSNHTT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |