Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d010309_circ_g.2 |
ID in PlantcircBase | zma_circ_009661 |
Alias | zma_circ_0002786 |
Organism | Zea mays |
Position | chr8: 109072072-109072540 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d010309 |
Parent gene annotation |
Squamosa promoter-binding protein-like (SBP domain) transcriptio n factor family protein |
Parent gene strand | + |
Alternative splicing | Zm00001d010309_circ_g.1 Zm00001d010309_circ_g.3 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d010309_T004:2 Zm00001d010309_T001:2 Zm00001d010309_T005:2 Zm00001d010309_T008:2 Zm00001d010309_T003:2 Zm00001d010309_T002:2 Zm00001d010309_T009:2 Zm00001d010309_T006:2 Zm00001d010309_T007:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.218902583 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
109072298-109072093(+) 109072078-109072086(+) 109072484-109072490(-) |
Potential amino acid sequence |
MTPRVHIHPRVQQGASHSSCMIGILQNFLDDYDTREHGRHNQ*(+) MEGITSEILETVLSNKVMDRETPVGSEDVLSSPTCTQPCLQNDQSKSVVTFAASVEACIGAKQE SIKLANSPMHDTKSAYSSSCPTGRISFKLYDWNPAEFPRRLRHQRTWKA*(+) MRPVGHEDEYALLVSCIGELASFMLSCFAPMQASTEAAKVTTLLLWSFCKQGCVQVGELSTSSD PTGVSLSITLLLRTVSRISLVMPSMFSGVVVVEEILQDSNHTT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |