Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0347500_circ_g.2 |
| ID in PlantcircBase | osa_circ_036828 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 15769096-15769192 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os08g0347500 |
| Parent gene annotation |
Similar to PsbP family protein, expressed. (Os08t0347500-00) |
| Parent gene strand | - |
| Alternative splicing | Os08g0347500_circ_g.3 |
| Support reads | 4 |
| Tissues | pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0347500-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.258594759 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15769125-15769131(+) 15769193-15769190(-) |
| Potential amino acid sequence |
MSREIWSLSCELKSVVSSSINIIHLQWQLHQAHVS*(+) MMLMDELTTLLSSQLKLQISRDMRLVQLPLQMNDVDGRTYYTFEFTAQAPNFTRHALGAIAIAN E*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |