Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G27860_circ_g.5 |
| ID in PlantcircBase | ath_circ_033233 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr4: 13875323-13875577 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, CIRI-full |
| Parent gene | AT4G27860 |
| Parent gene annotation |
vacuolar iron transporter (VIT) family protein |
| Parent gene strand | + |
| Alternative splicing | AT4G27860_circ_g.4 AT4G27860_circ_g.6 |
| Support reads | 12 |
| Tissues | root, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G27860.4:1 AT4G27860.2:1 AT4G27860.1:1 AT4G27860.3:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.494333956 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13875415-13875574(+) |
| Potential amino acid sequence |
MLPPNAQSEIPNSVEPRKGGNKVEILKSIVYGGLTESITSLCTVTSAAASGASTQNQKSHLTPI YPSPLEQPSKQIINKETQTEPMLPPNAQSEIPNSVEPRKGGNKVEILKSIVYGGLTESITSLCT VTSAAASGASTQNQKSHLTPIYPSPLEQPSKQIINKETQTEPMLPPNAQSEIPNSVEPRKGGNK VEILKSIVYGGLTESITSLCTVTSAAASGASTQNQKSHLTPIYPSPLEQPSKQIINKETQTEPM LPPNAQSEIPNSVEPRKGGNKVEILKSIVYGGLTESITSLCTVTSAAASGAST(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |