Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0644400_circ_g.1 |
ID in PlantcircBase | osa_circ_020774 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 24850993-24851410 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0644400 |
Parent gene annotation |
Amino acid permease. (Os03t0644400-01);Similar to Amino acid per mease. (Os03t0644400-02) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0644400-02:2 Os03t0644400-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_004984* |
PMCS | 0.368682974 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24851305-24851344(-) |
Potential amino acid sequence |
MLPEIQATIRPPVVKNMEKALWFQFTVGSLPLYAVTFMGYWAYGSSTSSYLLNSVKGPIWIKTV ANLSAFLQTVIALHGLPHLQRIILFLDHIQIESSLR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |