Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0397000_circ_g.1 |
| ID in PlantcircBase | osa_circ_023658 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 19599296-19600374 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0397000 |
| Parent gene annotation |
Defender against cell death 1 (DAD-1) (Defender against apoptoti c death 1 protein). (Os04t0397000-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0397000-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.250691728 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19599316-19599475(+) |
| Potential amino acid sequence |
MPRATSDAKLLIQSLGKAYAATPTNLKIIDLYVVFAVATALIQVVYMGIVGSFPFNSFLSGVLS CIGTAVLAVCLRIQVNKDNKEFKNTQDFEDAEGHERCEASNSVPGQGLCCHTNKSQDH*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |