Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0244500_circ_g.3 |
ID in PlantcircBase | osa_circ_027150 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 8771034-8771533 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0244500 |
Parent gene annotation |
Glycoside hydrolase, family 5 protein. (Os05t0244500-01);Similar to cellulase containing protein. (Os05t0244500-02) |
Parent gene strand | - |
Alternative splicing | Os05g0244500_circ_g.1 Os05g0244500_circ_g.2 |
Support reads | 2 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0244500-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_015200 |
PMCS | 0.2745352 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8771519-8771116(+) 8771529-8771528(+) |
Potential amino acid sequence |
MCSNDSGCEEVDHLHCLCDVSIRCSPLLRAISG*(+) MILDARKSITCTVSAMLASDVPHSCVPSLDELCSHGFCDPGAAWRSIITPSLYFSAHLKALSKV CRDPPTYGAGGLGSLAIHHPTGIRTAVNPLAEMNLKSSSTMYVLQ*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |