Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0244500_circ_g.3 |
| ID in PlantcircBase | osa_circ_027150 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 8771034-8771533 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0244500 |
| Parent gene annotation |
Glycoside hydrolase, family 5 protein. (Os05t0244500-01);Similar to cellulase containing protein. (Os05t0244500-02) |
| Parent gene strand | - |
| Alternative splicing | Os05g0244500_circ_g.1 Os05g0244500_circ_g.2 |
| Support reads | 2 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0244500-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_015200 |
| PMCS | 0.2745352 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8771519-8771116(+) 8771529-8771528(+) |
| Potential amino acid sequence |
MCSNDSGCEEVDHLHCLCDVSIRCSPLLRAISG*(+) MILDARKSITCTVSAMLASDVPHSCVPSLDELCSHGFCDPGAAWRSIITPSLYFSAHLKALSKV CRDPPTYGAGGLGSLAIHHPTGIRTAVNPLAEMNLKSSSTMYVLQ*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |