Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0256400_circ_g.2 |
| ID in PlantcircBase | osa_circ_018950 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 8259109-8259467 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0256400 |
| Parent gene annotation |
Similar to Imidazole glycerol phosphate synthase hisHF, chloropl ast precursor (IGP synthase) (ImGP synthase) (IGPS) [Includes: G lutamine amidotransferase (EC 2.4.2.-); Cyclase (EC 4.1.3.-)]. ( Os03t0256400-01) |
| Parent gene strand | - |
| Alternative splicing | Os03g0256400_circ_g.1 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0256400-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.245300882 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8259204-8259203(+) |
| Potential amino acid sequence |
MTLFARFDAFLRDGTFDPEVFGLRKFFKIESPVALCYYYGLLHHTGHLLLPQDPHYHLTEHQDM Q*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |