Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0256400_circ_g.2 |
ID in PlantcircBase | osa_circ_018950 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 8259109-8259467 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0256400 |
Parent gene annotation |
Similar to Imidazole glycerol phosphate synthase hisHF, chloropl ast precursor (IGP synthase) (ImGP synthase) (IGPS) [Includes: G lutamine amidotransferase (EC 2.4.2.-); Cyclase (EC 4.1.3.-)]. ( Os03t0256400-01) |
Parent gene strand | - |
Alternative splicing | Os03g0256400_circ_g.1 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0256400-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.245300882 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8259204-8259203(+) |
Potential amino acid sequence |
MTLFARFDAFLRDGTFDPEVFGLRKFFKIESPVALCYYYGLLHHTGHLLLPQDPHYHLTEHQDM Q*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |