Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0281000_circ_g.1 |
ID in PlantcircBase | osa_circ_014276 |
Alias | Os_ciR7619 |
Organism | Oryza sativa |
Position | chr2: 10425721-10425983 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os02g0281000 |
Parent gene annotation |
RmlC-like jelly roll fold domain containing protein. (Os02t02810 00-01);Similar to predicted protein. (Os02t0281000-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0281000-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.326728612 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10425927-10425971(+) 10425753-10425773(-) 10425935-10425773(-) |
Potential amino acid sequence |
MCIYAADCSEIGLVQLRGSGSKIPWFLKGMVQMIVPSGRRSYLIWNGKCAYMPLIAVRLVLSN* (+) MPFRNQGIFEPEPLSWTRPISLQSAAYMHIFHSKSDSCAFLKELSSAPCPLGTKESLSQNLLVG QDQSHCNQRHICTFSIPNQIAAPS*(-) MHIFHSKSDSCAFLKELSSAPCPLGTKESLSQNLLVGQDQSHCNQRHICTFSIPNQIAAPS*(- ) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |