Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0281000_circ_g.1 |
| ID in PlantcircBase | osa_circ_014276 |
| Alias | Os_ciR7619 |
| Organism | Oryza sativa |
| Position | chr2: 10425721-10425983 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os02g0281000 |
| Parent gene annotation |
RmlC-like jelly roll fold domain containing protein. (Os02t02810 00-01);Similar to predicted protein. (Os02t0281000-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0281000-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.326728612 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10425927-10425971(+) 10425753-10425773(-) 10425935-10425773(-) |
| Potential amino acid sequence |
MCIYAADCSEIGLVQLRGSGSKIPWFLKGMVQMIVPSGRRSYLIWNGKCAYMPLIAVRLVLSN* (+) MPFRNQGIFEPEPLSWTRPISLQSAAYMHIFHSKSDSCAFLKELSSAPCPLGTKESLSQNLLVG QDQSHCNQRHICTFSIPNQIAAPS*(-) MHIFHSKSDSCAFLKELSSAPCPLGTKESLSQNLLVGQDQSHCNQRHICTFSIPNQIAAPS*(- ) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |