Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0184900_circ_g.3 |
| ID in PlantcircBase | osa_circ_000597 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 4501153-4502341 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0184900 |
| Parent gene annotation |
Similar to SSRP1 protein. (Os01t0184900-01);Similar to SSRP1 pro tein. (Os01t0184900-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0184900-02:2 Os01t0184900-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_001857* osi_circ_011284 |
| PMCS | 0.234676654 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4502155-4501168(+) |
| Potential amino acid sequence |
MRYSPKFFVVYLVLKLQGQVLSEVAKMGMQLNRLSKLKMDCCIHLKRASSFCQSLPPSFYMKSL RQRQ*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |