Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0184900_circ_g.3 |
ID in PlantcircBase | osa_circ_000597 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 4501153-4502341 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0184900 |
Parent gene annotation |
Similar to SSRP1 protein. (Os01t0184900-01);Similar to SSRP1 pro tein. (Os01t0184900-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0184900-02:2 Os01t0184900-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_001857* osi_circ_011284 |
PMCS | 0.234676654 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4502155-4501168(+) |
Potential amino acid sequence |
MRYSPKFFVVYLVLKLQGQVLSEVAKMGMQLNRLSKLKMDCCIHLKRASSFCQSLPPSFYMKSL RQRQ*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |