Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0806900_circ_g.3 |
ID in PlantcircBase | osa_circ_017064 |
Alias | Os_ciR8196 |
Organism | Oryza sativa |
Position | chr2: 34465262-34466197 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os02g0806900 |
Parent gene annotation |
Pyridoxal phosphate-dependent transferase, major region, subdoma in 1 domain containing protein. (Os02t0806900-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0806900-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_004398* |
PMCS | 0.263312945 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
34465342-34465371(+) 34465279-34466075(-) |
Potential amino acid sequence |
MASLASTLEKLTHGNKRTEKIRRYIVVEAIYQNSGQIAPLDEIVRLKEKYRFRVILEESHSFGV LGKSGRGLAEHYGVPIEKIDIITAGMGNALATDGGFCTGSIRVVDHQRLSSSGYVFSASLPPYL ASAAISAVDHLEENPSVLANLRSNITLLHKVMRVFIGQYKMVCSFQEALLFISSTMTWLHLRAL WKN*(+) MNTLITLCRRVMFDLRLARTDGFSSRWSTAEIAALARYGGNEAEKT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |