Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0806900_circ_g.3 |
| ID in PlantcircBase | osa_circ_017064 |
| Alias | Os_ciR8196 |
| Organism | Oryza sativa |
| Position | chr2: 34465262-34466197 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os02g0806900 |
| Parent gene annotation |
Pyridoxal phosphate-dependent transferase, major region, subdoma in 1 domain containing protein. (Os02t0806900-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0806900-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_004398* |
| PMCS | 0.263312945 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34465342-34465371(+) 34465279-34466075(-) |
| Potential amino acid sequence |
MASLASTLEKLTHGNKRTEKIRRYIVVEAIYQNSGQIAPLDEIVRLKEKYRFRVILEESHSFGV LGKSGRGLAEHYGVPIEKIDIITAGMGNALATDGGFCTGSIRVVDHQRLSSSGYVFSASLPPYL ASAAISAVDHLEENPSVLANLRSNITLLHKVMRVFIGQYKMVCSFQEALLFISSTMTWLHLRAL WKN*(+) MNTLITLCRRVMFDLRLARTDGFSSRWSTAEIAALARYGGNEAEKT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |