Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0530801_circ_g.4 |
| ID in PlantcircBase | osa_circ_037803 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 26443574-26444000 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ui-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os08g0530801 |
| Parent gene annotation |
Hypothetical protein. (Os08t0530801-00) |
| Parent gene strand | - |
| Alternative splicing | Os08g0530801_circ_g.5 |
| Support reads | 4 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0531000-01:2 Os08t0531000-02:2 Os08t0531000-01:2 Os08t0531000-02:2 Os08t0530801-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.236321214 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26443770-26443622(+) 26443884-26443683(+) |
| Potential amino acid sequence |
MIASGNHERDWPNTGGFFDVKDSGGECGVPAETMYYYPAENRANFWRRETDQTSSPTTSQDL*( +) MRGTGPTPEGSSTSRTPAASAAFRQRPCTTTRPRIEPTSGGERRIKRVRQLPARISEHDGQAGR GSGQLRHCLPHR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |