Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0571100_circ_g.5 |
| ID in PlantcircBase | osa_circ_034449 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 23053629-23053872 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0571100 |
| Parent gene annotation |
Conserved hypothetical protein. (Os07t0571100-01);Hypothetical c onserved gene. (Os07t0571100-02);Hypothetical conserved gene. (O s07t0571100-03) |
| Parent gene strand | - |
| Alternative splicing | Os07g0571100_circ_g.3 Os07g0571100_circ_g.4 |
| Support reads | 3 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0571100-02:1 Os07t0571100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.366948122 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23053796-23053801(-) 23053642-23053801(-) |
| Potential amino acid sequence |
MVQRMPADEVAPKKLTLQLDLEKPSLGDEKSPSERRPQPALQQQKPKNEIKHEKSGCERKFRKE RRREATERAGDQFGG*(-) MKNLAARGNSEKKDAERPRRGLEINLEDDKMVQRMPADEVAPKKLTLQLDLEKPSLGDEKSPSE RRPQPALQQQKPKNEIKHEKSGCERKFRKERRREATERAGDQFGG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |