Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.001G154900_circ_g.1 |
| ID in PlantcircBase | gra_circ_000072 |
| Alias | Chr01:21691948|21692353 |
| Organism | Gossypium raimondii |
| Position | chrChr01: 21691948-21692353 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.001G154900 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | orai.001G154900_circ_ag.1 |
| Support reads | 11 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.001G154900.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.567528243 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21692159-21691974(+) 21692033-21692351(-) |
| Potential amino acid sequence |
MEKDGEAKWGNWIGYVLLPFTIARRDDPLDYVRDAKATIDRKKRSLEAIFTFSIAELALKLFGV KVGITKLKEQ*(+) MLMSKVDRRRIFFGRLSISIAPSALLFPP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |