Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0120800_circ_g.2 |
| ID in PlantcircBase | osa_circ_000163 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 1173796-1174169 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0120800 |
| Parent gene annotation |
Similar to Eukaryotic translation initiation factor 3 subunit 10 (eIF-3 theta) (Eukaryotic translation initiation factor 3 large subunit) (eIF3a). (Os01t0120800-01);Similar to Translation init iation factor 3. (Os01t0120800-02);Similar to Translation initia tion factor 3. (Os01t0120800-03);Similar to Translation initiati on factor 3. (Os01t0120800-04);Similar to Translation initiation factor 3. (Os01t0120800-05);Similar to Translation initiation f actor 3. (Os01t0120800-06) |
| Parent gene strand | - |
| Alternative splicing | Os01g0120800_circ_g.1 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0120800-06:2 Os01t0120800-04:1 Os01t0120800-03:2 Os01t0120800-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.399249086 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1174150-1173798(-) 1173850-1174150(-) |
| Potential amino acid sequence |
MELAMNEQFKERQEMEKKLQKTGKQMDYLERAKRQEEAPLIEQAFQKRLEVEKILHEQEQLREI ELSKQHHAGDLQEKNRLSRMLEHKEVTKEAVMELAMNEQFKERQEMEKKLQKTGKQMDYLERAK RQEEAPLIEQAFQKRLEVEKILHEQEQLREIELSKQHHAGDLQEKNRLSRMLEHKEVTKEAVME LAMNEQFKERQEMEKKLQKTGKQMDYLERAKRQEEAPLIEQAFQKRLEVEKILHEQEQLREIEL SKQHHAGDLQEKNRLSRMLEHKEVTKEAVMELAMNEQFKERQEMEKKLQKTGKQMDYLERAKRQ EEAPLIEQAFQKRLEVEKILHEQEQLREIELSKQHHAGDLQEKNRLSRMLEHK(-) MQVTCRRRTDFLECWSIRKLLRRL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |