Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0105600_circ_g.1 |
ID in PlantcircBase | osa_circ_029312 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 388173-388674 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os06g0105600 |
Parent gene annotation |
Conserved hypothetical protein. (Os06t0105600-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 8 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0105600-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_006459* |
PMCS | 0.141796066 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
388601-388664(-) |
Potential amino acid sequence |
MGLVSRSHHQAKLGEQNKFYYDEKLKRWVEEGADIPAEEPPLPPPPTKALFQNGIPDQSSNGPG SVSYTANGFSEARPLNPSGPSSGMPPMPPSQNQFSARGRMGVRSRVQD*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |