Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0105600_circ_g.1 |
| ID in PlantcircBase | osa_circ_029312 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 388173-388674 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os06g0105600 |
| Parent gene annotation |
Conserved hypothetical protein. (Os06t0105600-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 8 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0105600-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_006459* |
| PMCS | 0.141796066 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
388601-388664(-) |
| Potential amino acid sequence |
MGLVSRSHHQAKLGEQNKFYYDEKLKRWVEEGADIPAEEPPLPPPPTKALFQNGIPDQSSNGPG SVSYTANGFSEARPLNPSGPSSGMPPMPPSQNQFSARGRMGVRSRVQD*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |