Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0719900_circ_g.2 |
ID in PlantcircBase | osa_circ_021349 |
Alias | Os_ciR8791 |
Organism | Oryza sativa |
Position | chr3: 29186451-29187007 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os03g0719900 |
Parent gene annotation |
Similar to Peptide transporter 1. (Os03t0719900-01);Similar to P eptide transporter 1. (Os03t0719900-02);Similar to Peptide trans porter. (Os03t0719900-03);Similar to Peptide transporter 1. (Os0 3t0719900-04) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0719900-03:1 Os03t0719900-02:1 Os03t0719900-04:1 Os03t0719900-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_005067* |
PMCS | 0.542860443 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29186981-29186494(+) 29187006-29186994(-) 29186546-29186861(-) |
Potential amino acid sequence |
MLKESVQPSPEFIGVLQLPTPFNC*(+) MAVLTLSASVPTFMPPPCEGSFCPPANPLQYTVFFLGLYLIALGTGGIKPCVSSFGADQFDDTD PVERIQKGSFFNWFYFSINIGALISSSFLVWVQDNIGWGIGFGIPTIFMGLAIISFFSGTSLYR FQKPGGSPITRVCQVVVASFRKWNVHVPEDSSRLYELPDGASAIEGSRQLEHTDELRGWLY*(- ) MFQRIALACMSCLMGLQQLKGVGNWSTPMNSGDGCTDSFSISSYIHASTLRRVLLPTSKSIAVY CLFSWTLPNCSWYWWY*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |