Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0719900_circ_g.2 |
| ID in PlantcircBase | osa_circ_021349 |
| Alias | Os_ciR8791 |
| Organism | Oryza sativa |
| Position | chr3: 29186451-29187007 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os03g0719900 |
| Parent gene annotation |
Similar to Peptide transporter 1. (Os03t0719900-01);Similar to P eptide transporter 1. (Os03t0719900-02);Similar to Peptide trans porter. (Os03t0719900-03);Similar to Peptide transporter 1. (Os0 3t0719900-04) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0719900-03:1 Os03t0719900-02:1 Os03t0719900-04:1 Os03t0719900-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_005067* |
| PMCS | 0.542860443 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29186981-29186494(+) 29187006-29186994(-) 29186546-29186861(-) |
| Potential amino acid sequence |
MLKESVQPSPEFIGVLQLPTPFNC*(+) MAVLTLSASVPTFMPPPCEGSFCPPANPLQYTVFFLGLYLIALGTGGIKPCVSSFGADQFDDTD PVERIQKGSFFNWFYFSINIGALISSSFLVWVQDNIGWGIGFGIPTIFMGLAIISFFSGTSLYR FQKPGGSPITRVCQVVVASFRKWNVHVPEDSSRLYELPDGASAIEGSRQLEHTDELRGWLY*(- ) MFQRIALACMSCLMGLQQLKGVGNWSTPMNSGDGCTDSFSISSYIHASTLRRVLLPTSKSIAVY CLFSWTLPNCSWYWWY*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |