Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0276100_circ_g.1 |
| ID in PlantcircBase | osa_circ_001302 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 9665820-9666007 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, circseq_cup |
| Parent gene | Os01g0276100 |
| Parent gene annotation |
Similar to 3-isopropylmalate dehydrogenase, chloroplast precurso r (EC 1.1.1.85) (Beta-IPM dehydrogenase) (IMDH) (3-IPM-DH). (Os0 1t0276100-01) |
| Parent gene strand | + |
| Alternative splicing | Os01g0276100_circ_g.2 Os01g0276100_circ_g.3 Os01g0276100_circ_g.4 |
| Support reads | 4/4 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0276100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.349216135 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9665853-9665821(+) 9665978-9666002(-) |
| Potential amino acid sequence |
MALRRLLQGSVLPRMAGRAAAAPFSTASGETVRATLFPGDGIGPEIAESVKQGSSRKREEGGAW RYGGCSRGASCRGWRAEPPRRRSRRRPGRPSAPRSSQATASGRRSPSRSSRVAAGRGRKGGHGA TEAAPGERPAADGGQSRRGAVLDGVRGDRPRHALPRRRHRAGDRRVGQAG*(+) MPSPGKSVARTVSPDAVENGAAAALPAIRGRTLPWSSLRSAMPPLPPSSCCYPA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2016;Chu et al., 2017 |