Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0143400_circ_g.1 |
| ID in PlantcircBase | osa_circ_017876 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 2401819-2402080 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0143400 |
| Parent gene annotation |
Similar to mitochondrial chaperonin-60 [Oryza sativa (japonica c ultivar-group)]. (Os03t0143400-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0143400-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.230217875 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2402032-2401843(+) 2401885-2402046(-) 2401830-2402006(-) |
| Potential amino acid sequence |
MTDPSTPAFEAIVCTGVLQHPPELF*(+) MVKSGIIDPLKVIRTALVDAARPQCTQLLRMRV*(-) MLQDPSAHNCFECGCRRICHYWQAFGTG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |