Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0143400_circ_g.1 |
ID in PlantcircBase | osa_circ_017876 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 2401819-2402080 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0143400 |
Parent gene annotation |
Similar to mitochondrial chaperonin-60 [Oryza sativa (japonica c ultivar-group)]. (Os03t0143400-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0143400-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.230217875 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2402032-2401843(+) 2401885-2402046(-) 2401830-2402006(-) |
Potential amino acid sequence |
MTDPSTPAFEAIVCTGVLQHPPELF*(+) MVKSGIIDPLKVIRTALVDAARPQCTQLLRMRV*(-) MLQDPSAHNCFECGCRRICHYWQAFGTG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |