Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G15740_circ_g.1 |
| ID in PlantcircBase | ath_circ_038462 |
| Alias | AT5G15740_C1, AT5G15740_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 5135107-5135264 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | AT5G15740 |
| Parent gene annotation |
O-fucosyltransferase 34 |
| Parent gene strand | - |
| Alternative splicing | AT5G15740_circ_g.2 AT5G15740_circ_g.3 AT5G15740_circ_g.4 AT5G15740_circ_g.5 AT5G15740_circ_g.6 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT5G15740.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.620635477 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5135203-5135182(-) 5135148-5135235(-) |
| Potential amino acid sequence |
MAALDYLVALESDIFVPTNDGNMARVVEGHRRSGKKPYSNPLIWIFAGTIHLKWLHLIT* MMGTWQELLKVIAGPERNPTRIL* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Zhang et al., 2019 |