Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d046231_circ_g.2 |
ID in PlantcircBase | zma_circ_009971 |
Alias | Zm09circ00041, GRMZM2G171031_C1 |
Organism | Zea mays |
Position | chr9: 73629367-73630364 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d046231 |
Parent gene annotation |
K(+) efflux antiporter 4 |
Parent gene strand | - |
Alternative splicing | Zm00001d046231_circ_g.1 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d046231_T005:3 Zm00001d046231_T003:3 Zm00001d046231_T007:2 Zm00001d046231_T011:3 Zm00001d046231_T012:3 Zm00001d046231_T002:3 Zm00001d046231_T010:3 Zm00001d046231_T009:3 Zm00001d046231_T004:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.128760496 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
73630313-73629614(+) 73630315-73629689(-) |
Potential amino acid sequence |
MERSTPTKTPSFVLPPHRTSSLMQLREEGQMYHSKLEEAQTADQQHNPAI*(+) MSSTAVVLYVKVLKFLMERNSINALHGQVTVGTLILQDCAVGLLFALLPILSGTSGLLHGVASM TKSYVEAKQKKVFLLVCFSPCLQQLWFCT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |