Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.005G045200_circ_g.1 |
| ID in PlantcircBase | gra_circ_000446 |
| Alias | Chr05:4307895|4308116 |
| Organism | Gossypium raimondii |
| Position | chrChr05: 4307895-4308116 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.005G045200 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/4 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.005G045200.5:1 Gorai.005G045200.2:1 Gorai.005G045200.3:1 Gorai.005G045200.6:1 Gorai.005G045200.1:1 Gorai.005G045200.4:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 1.046918731 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4307982-4307897(+) 4307950-4307897(-) |
| Potential amino acid sequence |
MVAMVAMVAPMAALVVSFSLKRISWGSAAENCLPEAVSFSSAREKH*(+) MFHTSFNALAFNVAAPLNAFLVRLRSSQPLASNSLLQIPKKFSSGRSSPLKLPLELPLLPLPPF LLFSTGITAAMFHTSFNALAFNVAAPLNAFLVRLRSSQPLASNSLLQIPKKFSSGRSSPLKLPL ELPLLPLPPFLLFSTGITAAMFHTSFNALAFNVAAPLNAFLVRLRSSQPLASNSLLQIPKKFSS GRSSPLKLPLELPLLPLPPFLLFSTGITAAMFHTSFNALAFNVAAPLN(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |