Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0820100_circ_g.1 |
ID in PlantcircBase | osa_circ_022471 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 34413949-34414801 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0820100 |
Parent gene annotation |
Similar to Auxin-resistance protein AXR1. (Os03t0820100-01) |
Parent gene strand | + |
Alternative splicing | Os03g0820100_circ_g.2 Os03g0820100_circ_g.3 Os03g0820100_circ_g.4 Os03g0820100_circ_g.5 Os03g0820100_circ_g.6 Os03g0820100_circ_g.7 Os03g0820100_circ_g.8 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0820100-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.253511567 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
34414763-34414012(+) 34414104-34414769(-) |
Potential amino acid sequence |
MIYAFTIHGLNSSMDAECLGQSRAKSVCSFLQELNDAVNAKFVEESPLALIDTNPSFFSQFTVV IATQLPERSLLKLDDICRKANIVLVAARSYGLTGLVRISVKEHNVIESKPDHFLDDLRLHNPWV ELKHGCRMLGAIKSKICMFVPARAE*(+) MTTVNWEKNEGFVSMRARGDSSTNLAFTASFSSCRNEHTDFALDCPKHSASMLEFNPWIVKA*( -) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |