Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0347200_circ_g.9 |
| ID in PlantcircBase | osa_circ_019782 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 12986470-12986651 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0347200 |
| Parent gene annotation |
Armadillo-type fold domain containing protein. (Os03t0347200-01) ;Similar to Nuclear cap-binding protein CBP80. (Os03t0347200-02) ;Similar to Nuclear cap-binding protein CBP80. (Os03t0347200-03) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0347200-01:1 Os03t0347200-03:1 Os03t0347200-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.257438278 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12986615-12986509(+) 12986617-12986554(-) |
| Potential amino acid sequence |
MEIDNENGGDNDRNCLGYYSRALLKC*(+) MVVASGSRAEEFTFGSPARKLGTSPSAEIGGKRSVSTSTKLLNSNLSNSYRYLLHFHCLFPWLL LQGHGLKNLHSGLQHVN*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |