Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0170700_circ_g.6 |
| ID in PlantcircBase | osa_circ_010642 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 3595054-3595162 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0170700 |
| Parent gene annotation |
Conserved hypothetical protein. (Os12t0170700-01) |
| Parent gene strand | + |
| Alternative splicing | EPlOSAG00000009972_circ_ig.1 EPlOSAG00000009972_circ_ig.2 Os12g0170700_circ_igg.1 EPlOSAG00000009972_circ_ig.2 Os12g0170700_circ_g.1 Os12g0170700_circ_g.2 Os12g0170700_circ_g.3 Os12g0170700_circ_g.4 Os12g0170700_circ_g.5 Os12g0170700_circ_g.7 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0170700-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.348917278 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3595082-3595067(+) 3595107-3595067(+) 3595076-3595120(-) 3595114-3595128(-) |
| Potential amino acid sequence |
MVLRPLNSDDIEVNESSKCGFLDPFYQECCDW*(+) MTLKLMSQANVDFWIHFIKSAVTGEHTCMVLRPLNSDDIEVNESSKCGFLDPFYQECCDW*(+) MLTSHSTLDKMDPKIHICLTH*(-) MSSLFKGLKTIQVCSPVTALLIKWIQKSTFA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |