Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0170700_circ_g.6 |
ID in PlantcircBase | osa_circ_010642 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 3595054-3595162 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os12g0170700 |
Parent gene annotation |
Conserved hypothetical protein. (Os12t0170700-01) |
Parent gene strand | + |
Alternative splicing | EPlOSAG00000009972_circ_ig.1 EPlOSAG00000009972_circ_ig.2 Os12g0170700_circ_igg.1 EPlOSAG00000009972_circ_ig.2 Os12g0170700_circ_g.1 Os12g0170700_circ_g.2 Os12g0170700_circ_g.3 Os12g0170700_circ_g.4 Os12g0170700_circ_g.5 Os12g0170700_circ_g.7 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os12t0170700-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.348917278 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3595082-3595067(+) 3595107-3595067(+) 3595076-3595120(-) 3595114-3595128(-) |
Potential amino acid sequence |
MVLRPLNSDDIEVNESSKCGFLDPFYQECCDW*(+) MTLKLMSQANVDFWIHFIKSAVTGEHTCMVLRPLNSDDIEVNESSKCGFLDPFYQECCDW*(+) MLTSHSTLDKMDPKIHICLTH*(-) MSSLFKGLKTIQVCSPVTALLIKWIQKSTFA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |