Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0356700_circ_g.7 |
| ID in PlantcircBase | osa_circ_019894 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 13784905-13785045 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0356700 |
| Parent gene annotation |
Villin, villin/gelsolin superfamily protein, Actin binding prote in, Regulation of plant architecture (Os03t0356700-01);Similar t o predicted protein. (Os03t0356700-02) |
| Parent gene strand | + |
| Alternative splicing | Os03g0356700_circ_g.5 Os03g0356700_circ_g.6 Os03g0356700_circ_g.8 Os03g0356700_circ_g.9 Os03g0356700_circ_g.10 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0356700-01:1 Os03t0356700-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.327431915 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13784954-13785042(+) 13784973-13784941(+) 13784956-13784999(-) |
| Potential amino acid sequence |
MMVLDTHGEVFVWMGQCVDAKEKQKAFEIGQVTEIFNFSQDDLLTEDMMVLDTHGEVFVWMGQC VDAKEKQKAFEIGQVTEIFNFSQDDLLTEDMMVLDTHGEVFVWMGQCVDAKEKQKAFEIGQVTE IFNFSQDDLLTEDMMVLDTHGEVFVWMGQCVDAKEKQKAFEIGQ(+) MGKSLFGWVSVWMLKRSRRHLKLARSLKFSTFHKMIC*(+) MSSVSKSSCEKLKISVTWPISNAFCFSLASTH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |