Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0851700_circ_g.5 |
| ID in PlantcircBase | osa_circ_022753 |
| Alias | Os03circ32840 |
| Organism | Oryza sativa |
| Position | chr3: 35863482-35863621 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os03g0851700 |
| Parent gene annotation |
Similar to TGB12K interacting protein 3. (Os03t0851700-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0851750-00:1 Os03t0851700-01:1 Os03t0851750-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.298211905 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35863488-35863482(+) |
| Potential amino acid sequence |
MRAGSPGGRRGRGRGGQEQEHGAALRRRLRPQGLRRPPARPRRRRLKCAQVLLEAGAAVDAVDK NKNTALHYAAGYGRKDCVALLLDHGAAV*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |