Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0630900_circ_g.4 |
| ID in PlantcircBase | osa_circ_034880 |
| Alias | Os_ciR11117 |
| Organism | Oryza sativa |
| Position | chr7: 26161966-26162307 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Os07g0630900 |
| Parent gene annotation |
Similar to cDNA clone:J013000F18, full insert sequence. (Os07t06 30900-01);CSLA7 (Fragment). (Os07t0630900-02) |
| Parent gene strand | + |
| Alternative splicing | Os07g0630900_circ_g.1 Os07g0630900_circ_g.2 Os07g0630900_circ_g.3 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0630900-02:2 Os07t0630900-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.423216228 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26162041-26162064(+) 26162043-26162197(-) |
| Potential amino acid sequence |
MDLAVRASLNGWKFIYVGDIRVKSELPSTYGAYCRQQFRWACGGANLFRKIAMDVLVAKEPLEC GAQQPSMRQEVGRTALQLKTWTWQFEHP*(+) MSSTVVRSFQPPASLMAVVRHTPAVPWLPKHPLLSFGISLHHRRPTEIAVDSRLHKWTAVRS*( -) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |