Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0495100_circ_g.2 |
| ID in PlantcircBase | osa_circ_028359 |
| Alias | Os_ciR9996 |
| Organism | Oryza sativa |
| Position | chr5: 24315310-24315757 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os05g0495100 |
| Parent gene annotation |
Zinc finger, C2H2-type domain containing protein. (Os05t0495100- 01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0495100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.156329725 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24315710-24315319(+) 24315553-24315319(+) |
| Potential amino acid sequence |
MQISVLVVSNLRKSISSAGSEGRSVRREVADVQQKTKEASKTKPSVNFEKIPKKESQANTNVKG VLPGNFFDYNDEDEDPAPTEANSAPGNPPISNRMQVKGVPDGFFDGNKNSNGMQPSEPSQSSKA VKSSETSEVKGSLPEGFFDNKDADLRARGIQPPKIDIKRWF*(+) MQVKGVPDGFFDGNKNSNGMQPSEPSQSSKAVKSSETSEVKGSLPEGFFDNKDADLRARGIQPP KIDIKRWF*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |