Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0899500_circ_g.3 |
ID in PlantcircBase | osa_circ_005276 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 39133147-39133565 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0899500 |
Parent gene annotation |
Hypothetical conserved gene. (Os01t0899500-01);FMN-binding split barrel-related domain containing protein. (Os01t0899500-02) |
Parent gene strand | - |
Alternative splicing | Os01g0899500_circ_g.1 Os01g0899500_circ_g.2 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0899500-01:2 Os01t0899500-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.142204296 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
39133486-39133182(+) 39133562-39133231(+) 39133533-39133511(-) |
Potential amino acid sequence |
MSSGVLIQLKVTPAAIDKLQQRTIKYVLYYSSSSFHICQ*(+) MFSTTVLAVSTSVSDRSFFFGRSLTSSRGW*(+) MAAGVTFNWIKTPLDIRRFHDFSSLSFRCRNTFGSIQPSWLTTDQEPSFSKVRVAADYSDSVPD SKYTRDRGYHPLEEVKERPKKKDLSLTDVETARTVVENIFDRSLLEFINGSRGHF*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |