Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0532400_circ_g.5 |
ID in PlantcircBase | osa_circ_039966 |
Alias | NA |
Organism | Oryza sativa |
Position | chr9: 20886804-20887393 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os09g0532400 |
Parent gene annotation |
Signal transduction response regulator, receiver region domain c ontaining protein. (Os09t0532400-01);Signal transduction respons e regulator, receiver region domain containing protein. (Os09t05 32400-02) |
Parent gene strand | - |
Alternative splicing | Os09g0532400_circ_g.2 Os09g0532400_circ_g.3 Os09g0532400_circ_g.4 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os09t0532400-01:2 Os09t0532400-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_008199* |
PMCS | 0.128447825 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20887323-20887107(-) |
Potential amino acid sequence |
MGRHFSKPDHKNTEKNGGTKIHASNDGNLIPRREEDASLRRMTCSNDINCEKASRDMELVHIID NQQKNNTHMEMDVARANSRGNDDKCFSIPAHQLELSLRRSDYSRLESQEKNERRTLNHSTSSPF SLVHVQGQNWRLTVGKPTIYWNISSQWEGISPSLTTRTPRKMEGLKFMHLMMAT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |