Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0250200_circ_g.1 |
ID in PlantcircBase | osa_circ_018874 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 7932012-7932701 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0250200 |
Parent gene annotation |
TB2/DP1 and HVA22 related protein family protein. (Os03t0250200- 01);Similar to TB2/DP1, HVA22 family protein, expressed. (Os03t0 250200-02) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0250200-02:4 Os03t0250200-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_014133 |
PMCS | 0.34992378 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7932498-7932671(-) 7932063-7932671(-) |
Potential amino acid sequence |
MTVMERFGDFTISWLPFYSEAKLMFFIYLWYPKTKGTTYIYGTFFRPYISQHENEIDRNLLELR ARATDVVVLYFQKAATVGQNTFFDVLKYVASQSPSQRSSQQPSQVGLWLRLSSI*(-) MLLRNHHLRGQVNNLLRLAFGYAYPAYECYKTVELNKPEIEQLIFWCQYWILVALMTVMERFGD FTISWLPFYSEAKLMFFIYLWYPKTKGTTYIYGTFFRPYISQHENEIDRNLLELRARATDVVVL YFQKAATVGQNTFFDVLKYVASQSPSQRSSQQPSQVGLWLRLSSI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |