Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0250200_circ_g.1 |
| ID in PlantcircBase | osa_circ_018874 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 7932012-7932701 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0250200 |
| Parent gene annotation |
TB2/DP1 and HVA22 related protein family protein. (Os03t0250200- 01);Similar to TB2/DP1, HVA22 family protein, expressed. (Os03t0 250200-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0250200-02:4 Os03t0250200-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_014133 |
| PMCS | 0.34992378 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7932498-7932671(-) 7932063-7932671(-) |
| Potential amino acid sequence |
MTVMERFGDFTISWLPFYSEAKLMFFIYLWYPKTKGTTYIYGTFFRPYISQHENEIDRNLLELR ARATDVVVLYFQKAATVGQNTFFDVLKYVASQSPSQRSSQQPSQVGLWLRLSSI*(-) MLLRNHHLRGQVNNLLRLAFGYAYPAYECYKTVELNKPEIEQLIFWCQYWILVALMTVMERFGD FTISWLPFYSEAKLMFFIYLWYPKTKGTTYIYGTFFRPYISQHENEIDRNLLELRARATDVVVL YFQKAATVGQNTFFDVLKYVASQSPSQRSSQQPSQVGLWLRLSSI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |