Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0468550_circ_g.13 |
ID in PlantcircBase | osa_circ_042131 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 23000362-23000520 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRI-long |
Parent gene | Os05g0468600 |
Parent gene annotation |
Similar to UGP3 (UDP-GLUCOSE PYROPHOSPHORYLASE 3). (Os05t0468600 -00) |
Parent gene strand | + |
Alternative splicing | Os05g0468550_circ_g.1 Os05g0468550_circ_g.2 Os05g0468550_circ_g.3 Os05g0468550_circ_g.4 Os05g0468550_circ_g.5 Os05g0468550_circ_g.6 Os05g0468550_circ_g.7 Os05g0468550_circ_g.8 Os05g0468550_circ_g.9 Os05g0468550_circ_g.10 Os05g0468550_circ_g.11 Os05g0468550_circ_g.12 Os05g0468550_circ_g.14 Os05g0468550_circ_g.15 Os05g0468550_circ_g.16 Os05g0468550_circ_g.17 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0468550-01:1 Os05t0468600-00:1 Os05t0468550-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.242665514 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23000463-23000517(+) |
Potential amino acid sequence |
MVLNLKKAVSYLDHLGFECSLQANYPANTNILYVDLQAAEEVGSRKNASCLPGMVLNLKKAVSY LDHLGFECSLQANYPANTNILYVDLQAAEEVGSRKNASCLPGMVLNLKKAVSYLDHLGFECSLQ ANYPANTNILYVDLQAAEEVGSRKNASCLPGMVLNLKKAVSYLDHLGFEC(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | this study |