Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0468550_circ_g.13 |
| ID in PlantcircBase | osa_circ_042131 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 23000362-23000520 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRI-long |
| Parent gene | Os05g0468600 |
| Parent gene annotation |
Similar to UGP3 (UDP-GLUCOSE PYROPHOSPHORYLASE 3). (Os05t0468600 -00) |
| Parent gene strand | + |
| Alternative splicing | Os05g0468550_circ_g.1 Os05g0468550_circ_g.2 Os05g0468550_circ_g.3 Os05g0468550_circ_g.4 Os05g0468550_circ_g.5 Os05g0468550_circ_g.6 Os05g0468550_circ_g.7 Os05g0468550_circ_g.8 Os05g0468550_circ_g.9 Os05g0468550_circ_g.10 Os05g0468550_circ_g.11 Os05g0468550_circ_g.12 Os05g0468550_circ_g.14 Os05g0468550_circ_g.15 Os05g0468550_circ_g.16 Os05g0468550_circ_g.17 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0468550-01:1 Os05t0468600-00:1 Os05t0468550-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.242665514 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23000463-23000517(+) |
| Potential amino acid sequence |
MVLNLKKAVSYLDHLGFECSLQANYPANTNILYVDLQAAEEVGSRKNASCLPGMVLNLKKAVSY LDHLGFECSLQANYPANTNILYVDLQAAEEVGSRKNASCLPGMVLNLKKAVSYLDHLGFECSLQ ANYPANTNILYVDLQAAEEVGSRKNASCLPGMVLNLKKAVSYLDHLGFEC(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | this study |