Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0583900_circ_g.2 |
ID in PlantcircBase | osa_circ_020542 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 21508030-21509039 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0583900 |
Parent gene annotation |
DEAD-like helicase, N-terminal domain containing protein. (Os03t 0583900-01);Similar to Endoribonuclease Dicer homolog 2a. (Os03t 0583900-02);Similar to Endoribonuclease Dicer homolog 2a. (Os03t 0583900-03);Similar to Endoribonuclease Dicer homolog 2a. (Os03t 0583900-04) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0583900-03:2 Os03t0583900-01:2 Os03t0583900-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_013226 |
PMCS | 0.132121749 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21508816-21508107(+) 21508063-21509033(-) |
Potential amino acid sequence |
MSGSSSHGTSNSGKRESVSAPMACSSWQALRQTVSLRIEPSPSTLTVCTGLLLGRCRVHVPDAL SISNLGRGLKYLFLIEMDDANIFHGNTSIVLPTWQFK*(+) MLASSISIKNRYFNPLPRFDIDKASGTCTLHLPKSSPVQTVNVEGEGSILKETVCLKACQELHA IGALTDSLLPELDVPCDEEPDIVVENKIEQPSYFPEEFVDNWRSFSRLGIYYCYKISLEGCPKT ASPTDILLALKCDLGSDFTSSSFKLPGGQDNASVTMKYVGIIHLNQEQIF*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |