Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0583900_circ_g.2 |
| ID in PlantcircBase | osa_circ_020542 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 21508030-21509039 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0583900 |
| Parent gene annotation |
DEAD-like helicase, N-terminal domain containing protein. (Os03t 0583900-01);Similar to Endoribonuclease Dicer homolog 2a. (Os03t 0583900-02);Similar to Endoribonuclease Dicer homolog 2a. (Os03t 0583900-03);Similar to Endoribonuclease Dicer homolog 2a. (Os03t 0583900-04) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0583900-03:2 Os03t0583900-01:2 Os03t0583900-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_013226 |
| PMCS | 0.132121749 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21508816-21508107(+) 21508063-21509033(-) |
| Potential amino acid sequence |
MSGSSSHGTSNSGKRESVSAPMACSSWQALRQTVSLRIEPSPSTLTVCTGLLLGRCRVHVPDAL SISNLGRGLKYLFLIEMDDANIFHGNTSIVLPTWQFK*(+) MLASSISIKNRYFNPLPRFDIDKASGTCTLHLPKSSPVQTVNVEGEGSILKETVCLKACQELHA IGALTDSLLPELDVPCDEEPDIVVENKIEQPSYFPEEFVDNWRSFSRLGIYYCYKISLEGCPKT ASPTDILLALKCDLGSDFTSSSFKLPGGQDNASVTMKYVGIIHLNQEQIF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |