Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0776700_circ_g.4 |
| ID in PlantcircBase | osa_circ_016743 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 32831817-32832077 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0776700 |
| Parent gene annotation |
Similar to Single myb histone 6. (Os02t0776700-01);Similar to Si ngle myb histone 6. (Os02t0776700-02);Hypothetical conserved gen e. (Os02t0776700-03) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0776700-02:1 Os02t0776700-01:1 Os02t0776700-03:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.325922158 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32831950-32832047(-) 32831963-32832075(-) |
| Potential amino acid sequence |
MMLPLPTPLCFGIVIRVAKILVLQTLNILFTRCFYMYSFLPSVLLKIHRGAVRI*(-) MSMLDDASASHPALFWDCHQSRKNPCPADPEHPFHKMFLHVLLSSQCSS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |