Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0476500_circ_g.1 |
ID in PlantcircBase | osa_circ_033772 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 17255764-17256153 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0476500 |
Parent gene annotation |
Cyclophilin-like domain containing protein. (Os07t0476500-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0476500-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007173* osi_circ_017059 |
PMCS | 0.34302203 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17256133-17256147(-) 17255818-17256147(-) |
Potential amino acid sequence |
MPFRHVIKNFVIQGGDFDFNGAAQEWILKAKASGENALSPKHEAFMIGTTKNPNNKGFDLFITT APIPDLNDKLVVFGQVINGQDIVQQE*(-) MTSLLYLGKLSMDKILFSKSNHFKGMPFRHVIKNFVIQGGDFDFNGAAQEWILKAKASGENALS PKHEAFMIGTTKNPNNKGFDLFITTAPIPDLNDKLVVFGQVINGQDIVQQE*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |