Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d027536_circ_g.2 |
ID in PlantcircBase | zma_circ_006388 |
Alias | Zm01circ00023 |
Organism | Zea mays |
Position | chr1: 7689009-7697438 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d027536 |
Parent gene annotation |
Serine acetyltransferase 4 |
Parent gene strand | - |
Alternative splicing | Zm00001d027536_circ_g.1 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d027536_T005:2 Zm00001d027536_T008:2 Zm00001d027536_T002:2 Zm00001d027536_T007:2 Zm00001d027536_T003:2 Zm00001d027536_T009:2 Zm00001d027536_T004:2 Zm00001d027536_T006:2 Zm00001d027536_T001:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.056247424 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7697405-7689072(+) 7697351-7697383(-) |
Potential amino acid sequence |
MIQQYSLANFGSCGEVRPLKQGSQQQSWHLRLH*(+) MQGVTLGGTGKEHGDRHPKIGQGALIGASATILGNINVGEGAMIAAGSLVLKDVPPHSCQNWRG NIVGSWNRSSHW*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020 |